Dataset for protein Bcl2l10 of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A5F4WGS2_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L10 (length=187 residues).
MADPLRVVADYLECCFREPGTPESPPSTAEAAVLRAMAAGVRKLYRSFFSAYLLYPGNRGELVARMAEALLSDSPGPTWG
NVVMLLAFAGTLLERGPLVTARWKKWGFRSWLKEPEGDVARDCQRLVALMSPRLVGQHRAWLEAQGGWDGFCYFFRTSYS
LALWRKLLVQVFLSWLLTAAFIYFWTR
>gnl|bcl2dbpro|F7CT87_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L10 (length=192 residues).
MADPLRQRTEQLVTDYLEYCSREPGTPESPPSTAEAAVLRAVAASVRKLYRSFFSAYLGYPGNRVELVARMAEALLSDSP
GPTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARDCQRLVALLSSRLVGQHRAWLEAQGGWDGFCYFF
RTSSLLALWRKVLVQVFLSWLLTAVFIYFWTR
© 1998-2022Legal notice