Dataset for protein Mcl-1 of organism Cairina moschata domestica

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3GNC2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cairina moschata domestica GN=MCL-1 (length=422 residues).
MFALPRNALIGFNLYCGGGTGPGGGGGGGGGGGGPASTGGTPAPPPPSPHAAAPPPPFPAARGAPCSLLIGSAAAPRSLI
GSAAPPLWSPEEELDGCEPEAELGGPGGGGGGSLPGTPPELPTDELRQDSLELILRYLREAAGETEPGLKKFFPGLLGRP
GGVAGGDGVMEKALETLRRVGDGVLEKHELAFQGMLRKLEIKKEEDLQAVGEVAAHLFSDGVTNWGRVVTLISFGAFVAR
HLKSVKQEKSIGSLARIITDALVSSKREWLVSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIRKACAGR
IARGPMRIIALGAESGRSSVNRLGLRAQGDCFGFTPGVLASPRPKPRGLGVAGARYSELLVRAAPLSELRVRARRRLGKE
RSHPGGWQQVAGRRRSGAGAAR
© 1998-2022Legal notice