Dataset for protein Bcl-2 of organism Buteo japonicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0BN28_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Buteo japonicus GN=BCL-2 (length=199 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAAEDRAPLPPGLSPPAAAAAAVAAAAAAAAAAAAGTSSDHTGLVSPHPE
PPGSXARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVE
LYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
© 1998-2022Legal notice