Dataset for protein Unclassified of organism Branchiostoma lanceolatum

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A8J9YRV3_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Branchiostoma lanceolatum (length=186 residues).
MVTSDSRSIVTDYVFYKLNKKGLPWPNAPPLPPPTDAHRLMRELGDKFEERYKEQFDEMGDQLHLTPDTAYQKYHNVVAE
LFREGVRWGRLVALVAFTGACTVTAVEREMPQFVDRYVDWTVQYIDNNLAQWLQENGGWVDDLAGEQVTPPGLTWWRIPV
CLLTVGGDKNHLAGRTNDGRTCCVLG
>gnl|bcl2dbpro|A0A8K0AF88_uncBCL2L1-04 Putative BCL2-like 1 protein OS=[Eukaryota] Branchiostoma lanceolatum (length=273 residues).
MVGSTTQPHPILLTKTGEFYCSPPSSLLLARTGRKPKMSAASPQPLPTGLSPTSGCPGLSQLLGRQQKTVGLNEFGSLFH
LGENNNKIQHGRQQVQSHSDAENPIVAEAEELARFYIQTKISNRKPTPPNKTAATLQRTADELLERHQYFFNGMVNRLQI
SPETSYTTFKNVADEMLKDQTVNWGRVVALYAFAGRIAVHCREQNPEVAETVGEFLGKYVGSNLEGWIKENGGWETLNNV
FRKDQPVEVTLRNGLIFTAAALGAAATVLKLIS
>gnl|bcl2dbpro|A0A8K0AF88_uncBCL2L1-05 Putative BCL2-like 1 protein OS=[Eukaryota] Branchiostoma lanceolatum (length=236 residues).
MSAASPQPLPTGLSPTSGCPGLSQLLGRQQKTVGLNEFGSLFHLGENNNKIQHGRQQVQSHSDAENPIVAEAEELARFYI
QTKISNRKPTPPNKTAATLQRTADELLERHQYFFNGMVNRLQISPETSYTTFKNVADEMLKDQTVNWGRVVALYAFAGRI
AVHCREQNPEVAETVGEFLGKYVGSNLEGWIKENGGWETLNNVFRKDQPVEVTLRNGLIFTAAALGAAATVLKLIS
© 1998-2023Legal notice