Dataset for protein Unclassified of organism Bos taurus

[Download (right click)]

8 sequence(s)

>gnl|bcl2dbpro|A0A3Q1MEB8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos taurus (length=173 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEGTESDMEIPSAINGNPSWHVADSPAVNGAIGHSRSLDARKM
IPMTTVKQAVREASNEFELRYQQTFSDLTSQLHITPGTAYQSFEQENGDWDTFVELYENNTTESQKSQESFNCWSLMDVS
VAGVVPLGLLFNS
>gnl|bcl2dbpro|A0A4W2CHX7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos indicus (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYNCSQFNDIWKPTPNAINDNPPWHLADSPVVNGATGHSRSLDAQKVIPMTTVKQTLRET
DNQFELRYQQTFSDLTSQLHITTGTAYQSFEQNGGWDSFVKLYENNTATKSQKGQDRSNHWSLMGMTLAGIALLGSLFTH
SNYSPHYNHSYFIQACVPLPFVIAIENLQFNKTLRFVTCIDYKMCTCLNSSVSLKNESLERGSHGRTCLSATH
>gnl|bcl2dbpro|A0A4W2E8M1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos indicus (length=173 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEGTESDMEIPSAINGNPSWHVADSPAVNGAIGHSRSLDARKM
IPMTTVKQAVREASNEFELRYQQTFSDLTSQLHITPGTAYQSFEQENGDWDTFVELYENNTTESQKSQESFNCWSLMDVS
VAGVVPLGLLFNS
>gnl|bcl2dbpro|A0A4W2FHS8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos indicus (length=173 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEGTESDMEIPSAINGNPSWHVADSPAVNGAIGHSRSLDARKM
IPMTTVKQALREASNEFELRYQQTFSDLTSQLHITPGTAYQSFEQENGDWDTFVELYENNTTESQKSQESFNCWSLMDVS
VAGVVPLGLLFNS
>gnl|bcl2dbpro|A0A4W2FL65_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos indicus (length=188 residues).
LESRKYFSCYIWKPTPNAINDNPPWHLADSPAVNGATGHSRSLDAQKVIPMTTVKQTLRETDNQFELRYQQTFSNLTSQL
HITTGTAYQSFEQVMYELFWAGVNWGHMAFFSFGGTLHRNQIPTWMATYLNDHLEPWIQENGGWDSFVKLYENNTATKSQ
KGQDRSNHWSLMGMTLAGIALLGSLFNS
>gnl|bcl2dbpro|A0A4W2H7Y7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos indicus (length=195 residues).
IFIMKMSQSNRRLVVDFLSYKLSQKGYSWSRFNDVEENRTEASEGTKSDMETPMPSMTTHLGTWRIAFSDQTSQLHITPG
TAYQSFEQMMYELLQDGVNWGRIVAFFSFGGALCMESIDKETQVLVSQSTTWMATYLNDHLESWIQENGGWDTSVKLCEN
NTTTESQKGQERFNSWSLTGMTSAGTALLGLLLNS
>gnl|bcl2dbpro|A1L569_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Bos taurus (length=242 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QTQVLAPAPAPAPGMASTLAQALAPGLAQAVTPPAPRTNQTGEGTLTEALLQLQFDTDEDLGALLGNNTDPAVFTDLASV
DNSEFQQLLNQGVPMGPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGPPGLTNGLLSGDEDFSSIADVDFSALLSQI
SS
>gnl|bcl2dbpro|Q05KI9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos taurus (length=170 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
© 1998-2022Legal notice