Dataset for protein Unclassified of organism Bombus impatiens

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6P3DRA3_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bombus impatiens (length=297 residues).
MAGDDGAPPDNEILTDGEGQGASVRGEPHSRVGGILECDPPGNKNSSSQRVSNDNDYAGGSADTVIPQDRNGGGGTPIAG
DNGALCRYAIGTAHTAMSFIEVCQIRLQNFFPQLISSSRYTLCEDSIERTAECLANDVIRYLLKEDIYLISQDPVSRSMR
HNVYQMLNKHSILFASMVNRLNVVPDTAYEAFMGVADELFLHGGVTWARIVCLYAFMGRLALWARDRRMHTLKKKLPLYV
SRFIGEKVAHFIKGYGGWEQLCIEYPVAEEISGAIWRSLIMTGATLGLVATILTVTS
© 1998-2023Legal notice