Dataset for protein Unclassified of organism Biomphalaria glabrata

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A182YU15_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Biomphalaria glabrata (length=248 residues).
MSVDSVANNSFDMRQNKLMAGNNKNLFAQVTQRFGVLAVPGQGLNDISQVTEESTQTISNSPLEQVRRDAEFMAEDVVLN
FVEESPKKAPNRYCKTLRRTVKELSDRHDLVFKGMVNRLKLDENNAFQTFVIVADEIFEDGHVNWGRIVAVYTFAARVAK
YYSDTVSKCEIDKVSDPMVKTKSQQKKIALFVGKYVANKLGKWILDHGGWDAFVEYFPDQGEFEEKMWKGVLFTAIGLGA
LATVVASR
>gnl|bcl2dbpro|A0A182YU15_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Biomphalaria glabrata (length=248 residues).
MSVDSVANNSFDMRQNKLMAGNNKNLFAQVTQRFGVLAVPGQGLNDISQVTEESTQTISNSPLEQVRRDAEFMAEDVVLN
FVEESPKKAPNRYCKTLRRTVKELSDRHDLVFKGMVNRLKLDENNAFQTFVIVADEIFEDGHVNWGRIVAVYTFAARVAK
YYSDTVSKCEIDKVSDPMVKTKSQQKKIALFVGKYVANKLGKWILDHGGWDAFVEYFPDQGEFEEKMWKGVLFTAIGLGA
LATVVASR
>gnl|bcl2dbpro|A0A2C9KXW1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Biomphalaria glabrata (length=361 residues).
MSFRKNKKSTKKGSFVPEADFQVNISDDENTPALKLPPAQPINITDNKADRNETSGSLLFINAEPPPPPPSHSSRSNSSS
PPASNLASSSSTNYPASDVTLNTIGSSAHSNALDDPGEDIDYMDIEPYELTSPVSDVRNNFGLVPRKMSASKFLDSGGIK
HLQLLAQAHQESRSKLDRISGSKMNADAVDGANKEHDNKQEAPQRQKSKEELYGKIAKKLAEMADQYSSESAEANGAAAS
APLSDLEKEIISCLRSEGDRNSAIIEEKFEAMAAQTADEAYQRFKSTIKSSVNNELSWDHLAFVFYTTKAVISAVGKGTK
AASKAKEYSLEYISDTFATWIMDQGGFDTIMSSSDSDFDVD
© 1998-2022Legal notice