Dataset for protein Bfl1 of organism Anas zonorhyncha

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9UZT1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Anas zonorhyncha GN=BCL2A1 (length=172 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDISSVDVAKRIFNGVMDEKFA
DGNTNWGRITTIFTFGGLLTKKLQEHGVQLTGEKKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
DLFVAVFSLFRE
© 1998-2022Legal notice