Dataset for protein Mcl-1 of organism Anas platyrhynchos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9SWV2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anas platyrhynchos GN=MCL-1 (length=182 residues).
MFALPRNALIGFNLYCGGGTGPGGGGGGGGGPASPGGTPKALETLRRVGDGVLEKHELAFQGMLRKLEIKKEEDLQAVGE
VAAHLFSDGVTNWGRVVTLISFGAFVARHLKSVKQEKSIGSLARIITDALVSSKREWLVSQGGWEGFVDFFRVEDLEGSI
RNVLMAFAGVAGLGASLAYMIR
© 1998-2023Legal notice