Dataset for protein Bcl-xL of organism Amphiprion clarkii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6G7K5D7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Amphiprion clarkii GN=BCL2L1 (length=208 residues).
MSYSNRELVEFFVSYKLSQRNYPTSLLRPEDAGGRTDGDKANSASSNGLLVNSRGGIEAVKSALKDAADEFELLFTQAFS
DLSSQLDITPETAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECVEKNMSELVPRIADWMTMYLDEHISLWIQSQG
GWECFAEIFGQNAAAEARRSRDTLKRWLLVGGVLLMGVLAGVLIAKKQ
© 1998-2020Legal notice