Dataset for protein Unclassified of organism Amazona collaria

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9FCV2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Amazona collaria (length=120 residues).
MSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSTLVGSIAAWMTEYLNRHLHNWIQDNGG
WVCPPIACSCSRLRPVAAVSMGLFWKTAFVVIRWVTVFLG
© 1998-2022Legal notice