Dataset for protein Bfl1 of organism Ailuropoda melanoleuca

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1LIJ8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2A1 (length=218 residues).
MHTEIPPASTPPMSHGPSPAGTRLFGLGCWRRSRRPAGQRGGWKMTDCEFGYTLTLAQDYVKHVLQIPQPGSAPSRASQV
LRDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWGRIVTIFAFEGILTKKLLRERISPDVDASR
ISYFVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVTGKICEMFSLLKQYC
© 1998-2022Legal notice