Dataset for protein Bcl-2 of organism Accipiter nisus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9RWH9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Accipiter nisus GN=BCL-2 (length=247 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAAEDRAPLPPGLSPPAAAAAAVAAAAAAAAAAGTSSDHTGLVSPHPEPP
GSAAASHAPPAEGLPPAPQVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFE
FGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITL
GAYLGHK
© 1998-2022Legal notice