Dataset for protein Bok of organism Falco tinnunculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4U8P8_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Falco tinnunculus GN=BOK (length=213 residues).
MEVLRRSSVFAAEVMEVFDRSPTDKELVSQAKALCRDYINSRLIRAGVSWSKPEYNAPVPGGKLAEVSTILLRLGDELEY
IRPNVYRNIARQLNISLHSETVVMDAFLAVAAQIFTAGITWGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFVRK
TLVTWLKRRGGWADITKCVVNTDPSLRSHWLVAAVCSFGHFLKAIFFVLLPER
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice