Dataset for protein Bax of organism Echeneis naucrates

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A665U5E7_BAX-01 BCL2-associated X protein OS=[Eukaryota] Echeneis naucrates GN=BAX (length=206 residues).
MSDSQGEEGRDGGELEPQGAVGGGDVIDDPILEQGAVVLRGYVIERINTEDPARHVSSEDLGGRPDEQHDPRVKEVVEQL
LKIADDLDRNVEFQRLINQVQGNCAQDIFMQVARSIFTDGINWGRVVALFHLAYRLIHKALTTNHIENIRMVISWVLQVI
REQLYSWLIQQGGWEGVIHGFSRWRTFTAVASVVLVAAIVYYRKTR
>gnl|bcl2dbpro|A0A665VGJ2_BAX-01 BCL2-associated X protein OS=[Eukaryota] Echeneis naucrates GN=BAX (length=193 residues).
MASSHPAGGDQGNTKEQILEVGAVLLKDFIYQRVQQHGDGNAQVTRAQLGGRELVDPNHKKLAECLQKIGDELDGNVELQ
RMINDPSVNPTKDMFLKVAIEIFSDGKFNWGRVVALFYFACRLVIKALVTQVPDIIRTIISWTMDYLRENVINWIREQGG
WEGIRSYFGTPTWQTVGVFLAGVLTTVIVIRKM
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice