Dataset for protein Unclassified of organism Dromaius novaehollandiae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4P2A3_uncBAK1-01 Putative BCL2-antagonist/killer 1 protein OS=[Eukaryota] Dromaius novaehollandiae (length=169 residues).
MKIVDTTRNQGIVFHIFLQNKMSQTRRTPRHFVLSSYPSGAPGEESYSRLLTIPDTTQQMEFNISSAVQVGHQLAIIGDE
FNRTYNRKFEDALLHLARGIAISVFQTWNFIKSVIRSFGNLLNNNWTKRIIGYGSWICRLPFRCVCQKLVPAALLVVAFW
WTINYGLQN
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice