Dataset for protein BAX-like of organism Dromaius novaehollandiae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4K7A5_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Dromaius novaehollandiae GN=BAK1 (length=217 residues).
MASGNNGDPPGPRVRWDGDGRRPSQEVNSEDQVVEQTEEVFRSYAFHRYQQEREERGEEVPMDPEIAEIQQEPSSTGSLV
GRRLAIIGDDINKRYDAEFRCMLKSLQPNKENAYEYFTRIAHSLFESGINWGRVIALLGFGYRMAIHVYQHGMTGFLRWI
ARCVAEFMLRNRIAQWIAQQGGWVAALDLDNVYMKYMLAVVALVMVGHLVVRRFFRP
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice