Dataset for protein BAX-like of organism Clytia hemisphaerica

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A7M5TR16_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Clytia hemisphaerica GN=BAK1 (length=254 residues).
MEWMNTVVSLVHNDENRSENDVEEVIQEAEEILRCCIFKLLEKVIHQEVDNGQFDFSSLPEHITKELKAIREYLIKCKNS
DDSSYVHHQIIAVMDSQLDCTLKRHHQTFHKLTASLDLSSEFNFAYESFVRIAKRFIDGEITWFRVVSLLCFGAELSVAV
IKKGGPGVQGFIKRIVHYVTEFLLKEEVADWISTHGGWMTMVNFFDSVDCPHRHDHLFDLIFITETTSFEKWVKRIAFGT
VLLGIGYTISKRLS
>gnl|bcl2dbpro|A0A7M5UJI6_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Clytia hemisphaerica GN=BAK1 (length=244 residues).
MAAAAPDPNDDPNEFFKRRPPYDKDVSFDQTNLEEDQKQVAEESEKIFKTFLYTRLLSDIERDSEDGEMCVGEITTPVIH
QIRDEKTNMEEKFNQDEQDKKILELGQMLAAVGDNYNKKYDFQSIVGNLNIEHEEFAYTSFTNVARKLVVGGLNWGRILA
LFLFGYEIALSFLRKGHSGVYGLLKRILKYMVKFLFKEGIVNWIIEQGGWIKFKLQENRESVNYALMILASLLAGYGAYR
LYNR
>gnl|bcl2dbpro|A0A7M5XF08_BAX-01 BCL2-associated X protein OS=[Eukaryota] Clytia hemisphaerica GN=BAX (length=313 residues).
MGPPIGGGGGGNKPPPSFFPNQNVDNNRQYPPQNQQQTFQQNEQYNSQPPYTSTPIADQAANHQYQPQPEQRSVRMRPQP
ANTRPQYPGYGPMVSGSSIQQPQVVPPPGQEQQDFDEEDGRPGYGPRVNVNVHYQEAQQQQIGNATPDIFTSFLVNRMEN
DGYDVPQQLRRRQGGNNEREIAKVLQRIGDDMSNHSQLNNLISGIRVTPDTVYKTFFSVASEIFSDGNINWGRICTLFYF
AYKLAIQVLNEMPLVDIVIDWVKRYVFDKLVGWILARGGWKAVHEYFGATPKQLVFVFLAGVAISSMFWYWKK
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice