Dataset for protein Bok of organism Chelydra serpentina

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C3RTI8_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Chelydra serpentina GN=BOK (length=213 residues).
MEVLRRSSVFAAEVMEVFDRSPTDKELVSQAKVLCRDYIHSRLLRAGIGWSKPEHSAPTPGGRLAEVSSVLLRLGDELEY
IRPNVYRNIARQLNISLHSETVVTDAFLAVAAQIFTAGVTWGKVVSLYAVAAGLAVDCVRQAQPAMVHAIVDCLGEFVRK
TLVTWLKRRGGWADITKCVVNTDPSLRSHWLVAAICSFGHFLKAIFFVLLPER
>gnl|bcl2dbpro|A0A8C3RTI8_BOK-02 BCL2-related ovarian killer protein OS=[Eukaryota] Chelydra serpentina GN=BOK (length=133 residues).
MGPNVYRNIARQLNISLHSETVVTDAFLAVAAQIFTAGVTWGKVVSLYAVAAGLAVDCVRQAQPAMVHAIVDCLGEFVRK
TLVTWLKRRGGWADITKCVVNTDPSLRSHWLVAAICSFGHFLKAIFFVLLPER
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice