Dataset for protein BAX-like of organism Anas platyrhynchos platyrhynchos

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A493TW00_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BAK1 (length=301 residues).
MVWGWVSNFFFFFSVSLLLFPPPPRPCSLPSPAPRRCAPGRRQEGSGGDGAAPRRDALGLPGTPPGPPGPRREPVKLILP
SISAMASGNDGDPPRAHGRRGSNGRRLSQELNSEDQVAQETEEVFRSYAFYRYQQEREESGEEVPLDPEIAEIQQDLGST
GSLVGRRLAIIGDDINKRYDAEFRYMLKSLQLTKENAYDYFIKIASSLFESGINWGRVIALLGFGYCMAIHVYQHGITGF
LRRIARYVTEFMLRNRIAQWIAQQGGWVAALDLDNVYMKYMLAVVALVMVGHLVVRRFFRP
>gnl|bcl2dbpro|A0A493TW00_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BAK1 (length=306 residues).
MVWGWVSNFFFFFSVSLLLFPPPPRPCSLPSPAPRRCAPGRRQEGSGGDGAAPRRDALGLPGTPPGPPGPRREPVKLILP
SISAMASGNDGDPPRAHGRRGSNGRRLSQELNSEDQVAQETEEVFRSYAFYRYQQEREESGEEVPLDPEIAEIQQDLGST
GSLVGRRLAIIGDDINKRYDAEFRYMLKSLQLTKENAYDYFIKIASSLFESGINWGRVIALLGFGYCMAIHVYQHGITGF
LRRIARYVTEFMLRNRIAQWIAQQGGWVAALDLDNVYMKYMLAVVALVMVGHLVVTIRLETVTGPV
>gnl|bcl2dbpro|U3ISP2_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BOK (length=213 residues).
MEVLRRSSVFAAEVMEVFDRSPTDKELVSQAKALCRDYINSRLVRAGVSWSKPECNAPVPGGKLAEVSTILLRLGDELEY
IRPNVYRNIARQLNISLHSETVVTDAFLAVAAQIFTAGITWGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFVRK
TLVTWLKRRGGWADITKCVVNTDPSLRSHWLVAAVCSFGHFLKAIFFVLLPER
© 1998-2020Legal notice