Dataset for protein Unclassified of organism Xenopus tropicalis

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A6I8R0S7_uncHRK-01 Putative Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Xenopus tropicalis (length=84 residues).
MCPLPFRASLPEVCVCNSERPGEICSRVHVTAARLRMVGDELHRLTVSRKNSFGRKRLCSCFYLLYTATHLAALALLMQG
RRNL
>gnl|bcl2dbpro|A0A6I8SZ38_uncHRK-01 Putative Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Xenopus tropicalis (length=115 residues).
MSRSVLCENSYALFLLGCPCTPHKACVCSNGRPGDICSRVHVTAARLRMVGDELHRLTVSRKNSFGRKKLCSCFYLLYMA
THLAALWQPCLPVIHCGSLHKHRLTPRHCLVVALY
© 1998-2020Legal notice