Dataset for protein Bmf of organism Xenopus tropicalis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F6TGJ4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Xenopus tropicalis GN=BMF (length=183 residues).
MEQESYLNMDELDDDVFYPDEFGYPDQTMTSSTVFNQSQSYTCLLSRFHLFPLSHCCGPGCRGADYEDKATQTLGSPSIS
QDIMLPCGVSETPQRLFYGHAGYLLYLPQNSPARFGEEVDNRRQEQSAEHRIARKLQCIGDQFHRFHLQRLQQNRNQFWS
QILIFFRNLVMHPVGNRAGLAQR
© 1998-2021Legal notice