Dataset for protein Bad of organism Vulpes vulpes

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q7SWS0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Vulpes vulpes GN=BAD (length=157 residues).
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTDEDEGMEEEEL
SPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
© 1998-2020Legal notice