Dataset for protein Hrk of organism Vombatus ursinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4X2K3J4_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Vombatus ursinus GN=HRK (length=97 residues).
MCPCPLHRGRGPPAVCACSSGRLEQRAAAAAQLTAARLKALGDELQERTMWRRRARSRRAAAEAAGSGGGLPACWAWLCA
AAQVAALAAWLLRRRNL
© 1998-2020Legal notice