Dataset for protein Bmf of organism Vombatus ursinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4X2KLG2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Vombatus ursinus GN=BMF (length=184 residues).
MEPPHYVEELEDDVFHPEDSEPGAQPGGLTSAALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPANFPVSLRLGEEPPQEQWEHRTEVQIARKLQCIADQFHRLHMQRHQQNRNHVW
WQILLFLHNLALNREENRNGAGPR
© 1998-2020Legal notice