Dataset for protein Bim of organism Vombatus ursinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4X2L9J9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2L11 (length=141 residues).
MAKQPSDLNSECHREGGQLHPTERPTQPQQLRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQS
QSIPADMRPEIWIAQELRRIGDEFNAYYPRRGFLDNNYQADHQMVILRLLRYIIRLVWRMQ
© 1998-2020Legal notice