Dataset for protein Bad of organism Vombatus ursinus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4X2KAA5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Vombatus ursinus GN=BAD (length=180 residues).
MSMFQISEFEPSEQETPKEDGFAYAPGESRGLGKHSATAPSLAPVRPGPRPAPGAHHHEGAGAGAGDRRPRLISYPPLRE
GPGEASPEAEAEADFFEGEEERSLFRSRSSSAPPILWAARRYGSELRRMSDEFDCTFKGLPRPKSAGTASQMRRSHGWAR
TFQSWLSRSLGKGSAAGPSH
© 1998-2020Legal notice