Dataset for protein Bmf of organism Terrapene carolina triunguis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A674IPL3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Terrapene carolina triunguis GN=BMF (length=192 residues).
MDPPSYLEEDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTL
SPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREARTEVQIARKLQCIADQFHRLHIQRH
QQNRNQVWWQILLFLHNLALNVEANRNNVGQR
© 1998-2020Legal notice