Dataset for protein Bim of organism Terrapene carolina triunguis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A674IAI8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Terrapene carolina triunguis GN=BCL2L11 (length=203 residues).
MAKQSSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNHSGEGDFTQQPSGSSSPSSPQGPFAPPSSPSPFA
TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWESPSVREDMQPEIWIAQEL
RRIGDEFNASYCPRRGFLDNPAVNHQIVLRLLRSIIRLIWRLQ
© 1998-2020Legal notice