Dataset for protein Bad of organism Terrapene carolina triunguis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A674I2R9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Terrapene carolina triunguis GN=BAD (length=141 residues).
MFRIQEFPDEVFPGRGKESPLPPESQRGHTPGSKQPDTPTAEVRSRIGSDPPSLEPEVQDEPGGAFRARSRSAPPILWAA
MRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHRGNSWKETLQAWLGHRPARDAPPRSSK
© 1998-2020Legal notice