Dataset for protein Unclassified of organism Takifugu rubripes

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A674MBG0_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Takifugu rubripes (length=216 residues).
MDSRAPSLTRFATGPLFHCCRKSWKPKLTKTLCSSNRPPNRPDGWPPVIATRAAEGAPGQTSRSVNGGEQSPTRTGEPNQ
MPRRRVPSSPFDSLGVFQTRTIFALPRRRSSGYFSSDSDSMPNSPLSPRPPTIDSATQTPSPSGQVMLHALERMAQRFGG
VGARAQQWHGEHMQPAVVSMEAGRGMLVVPLLHSLLLPHPVLLIQPLFDFFCLLVS
© 1998-2020Legal notice