Dataset for protein Noxa of organism Taeniopygia guttata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A674HDV6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Taeniopygia guttata GN=PMAIP1 (length=78 residues).
MPGRTLRKTAPPAAPAAVECALELTRIGDRWDLRQRLLNLLAKLFCPGTWAARGHGERNGGGPWLCGFGRRGSTDTGR
© 1998-2020Legal notice