Dataset for protein Bim of organism Taeniopygia guttata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A674H354_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Taeniopygia guttata GN=BCL2L11 (length=189 residues).
MAKQPPEVKARRDGEGGRLPAAEGPGPGAQLRPGAPAALPGAGPVSAGAAARGPPASPGPFATRSPLFIFVRRSPLLPRS
SSGYFSFDAERSPAPLGCDKATQTPSPPCQALSHCLSAMASRWQSHSPAEEVQPEIWIAQELRRIGDEFNASYCPRRGFL
DQQVGNPQVMILRLLRLLHSIIRLIWRLH
© 1998-2020Legal notice