Dataset for protein Bad of organism Taeniopygia guttata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A674GQ16_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Taeniopygia guttata GN=BAD (length=197 residues).
MLRLDETPEDRGSPPPSPWGGSPSPSQPGTPSPGQRLPPTQNPPPGGTPKPPGGTPKAIFGGPLTPLPPQRRGPGCCRSG
GGAGGGGDPQIGAPPGDPPPARGRSRSAPPVLWAAQRYGRRLRRMSDEFQLQVLPRPRSVGGAPPGGGGWRETLRAWWGS
RRPRPAPPAPPPDRPPPQKPHLGRGAPKCCREWGGGQ
© 1998-2020Legal notice