Dataset for protein Bmf of organism Suricata suricatta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A673TA87_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Suricata suricatta GN=BMF (length=293 residues).
CFQGKVRTFVTVPGSRPARDLGLHSPLAGRGRDAREAGPHQLFAGCPERAYFGNNTARATVASTRASPPAAAAAPASASR
HPPQPAGLFPSFPIESGRQAPECSSRWTLARSPGITTRRRRLSPGVTQQGRWSQPGSLLSANLFAQSQLDCPLSHLQLFP
LTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEV
QIARKLQCIADQFHRLHMQQHQQNRNRVWWQLLLFLHNLALNAEENRNGAGPR
© 1998-2020Legal notice