Dataset for protein Bmf of organism Sphaeramia orbicularis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A673C8N3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sphaeramia orbicularis GN=BMF (length=163 residues).
MEDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGLALAPNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELFGDPVRRQ
VSEEEEQNGMEQLPRQQPMARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAALLSLLFDRGFIAGRGGA
GQR
© 1998-2020Legal notice