Dataset for protein Bim of organism Sphaeramia orbicularis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A673CKA1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sphaeramia orbicularis GN=BCL2L11 (length=162 residues).
VAPCVKSLKRAYCSASGELSPGFTGPTGEGREPDSPSQIGVKATLLSDSLSRFQMRSIFRGRRRSSGYFSYESDSLPDSP
PSPRPMTADKATQTPSLTAQVMIHALERTAEAHGEGAFLTHDVWLSVSVEYTLGEYAEELVRVLLRTRRQHSEGNKLHSC
KL
© 1998-2020Legal notice