Dataset for protein classical BH3-containing proteins of organism Spermophilus dauricus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C9NXU1_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Spermophilus dauricus GN=BIK (length=177 residues).
MSEARPVSRSLPSLLRYRPGPLLAAGASCMTPPAGEEVLRPGGRLHLMVQGSNQVALRLACIGDEMDLCFRGLQLAQLPG
MVPYLLGPSLSSLGPQVPPARACRELLPVLLLLGLLLSRALPVPEAPVRPVRGGAGPRPLNPSWRWPAPGGSVLWTVVFP
DEISFFIFKLKIVLGHC
>gnl|bcl2dbpro|A0A8C9PN82_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Spermophilus dauricus GN=BAD (length=172 residues).
MFQIPEFEPSEQEDSSSAEGGLGPSPAGGQPGPYKNQPPGCGLAPGLPRDTGHQQRQATSSSNHGGRSAGATETRSRHSS
YSADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPRSAGTASQMRQSSSWTRFIQSWWD
RNLGRRGSAPSQ
>gnl|bcl2dbpro|A0A8C9PPC0_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Spermophilus dauricus GN=BCL2L11 (length=109 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASMRESQAEPADMRPEIWIAQELRRIGDEFNLYYPRRVF
FNNYQPEDRPQMVILRLLRCIIRLVWRMH
>gnl|bcl2dbpro|A0A8C9PPC0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Spermophilus dauricus GN=BCL2L11 (length=199 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGEGDRCPHGSPQGPLAPPASPGPFASSPLTRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRESQAEPADMRPEIWIAQELRRIGDE
FNLYYPRRVFFNNYQPEDRPQMVILRLLRCIIRLVWRMH
>gnl|bcl2dbpro|A0A8C9Q5W2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Spermophilus dauricus GN=PMAIP1 (length=50 residues).
DAGKKLSKHALNPTQVSAEVEIEGMSQLRRFGDKLNFHEKLLNLIFRPFS
>gnl|bcl2dbpro|A0A8C9QDA0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Spermophilus dauricus GN=BMF (length=200 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGRCSYLGAKPPSVHHAGPWRRALASRLGGRDSLLESPRCVCVCVCVCVCVCVCVFVRSAVLSA
VEARGVWLLPSPTKRRSLSSASLVEPLGAGMAPTGFSSLC
>gnl|bcl2dbpro|A0A8C9UJQ6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Spermophilus dauricus GN=PMAIP1 (length=54 residues).
MPGKKGWKNEQLPPATPATPVELESGIQLRRFGDKVNFRQKLLNLISKLFSLVT
>gnl|bcl2dbpro|A0A8C9UST6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Spermophilus dauricus GN=BMF (length=189 residues).
VFPEEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGSAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQN
RNRVWWQILLFLHNLALNGDENRDRAGPR
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice