Dataset for protein Bmf of organism Spermophilus dauricus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C9QDA0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Spermophilus dauricus GN=BMF (length=200 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGRCSYLGAKPPSVHHAGPWRRALASRLGGRDSLLESPRCVCVCVCVCVCVCVCVFVRSAVLSA
VEARGVWLLPSPTKRRSLSSASLVEPLGAGMAPTGFSSLC
>gnl|bcl2dbpro|A0A8C9UST6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Spermophilus dauricus GN=BMF (length=189 residues).
VFPEEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGSAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQN
RNRVWWQILLFLHNLALNGDENRDRAGPR
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice