Dataset for protein Unclassified of organism Sparus aurata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A671V631_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Sparus aurata (length=152 residues).
MDDEEEDMSRPISQLWGTPFRDVKYEDRATQIAAGQALAAVTAAVSTSQSHNNNSIGINTLPCSLLRQPRIPFHGNAGLR
SHFPAQFEPMEDRGERQIEEEEEEDRGEEDDRMAEGPAEQAGVSVEAQIGRKLREIGDKFQQDHVELVSLTP
© 1998-2020Legal notice