Dataset for protein Bmf of organism Sparus aurata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A671X848_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sparus aurata GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALYNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QDSGGEQSGMEQLPRPQPVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALINLLFDRRFIAGGGGA
GRR
© 1998-2020Legal notice