Dataset for protein Bim of organism Sparus aurata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A671W556_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sparus aurata GN=BCL2L11 (length=245 residues).
MQHPSRPPNSSDGSTAVTAGQGSGGDPSPAGAAGASAQTSRSDTGGVPSSGQPSTSGGGEPDSPCWRRGKTISPLDSLGV
FQTRSIFHLPRRASSGYFSSDGDSLPSSPLSPRPLTVDRATQTPSPTGQVMQHALQRMAEERGPGTHQLHGHSPSPSSTR
PQNAAGDMQAEAIGRELRRIGDDFNRQLLLRGVAGGQRRIVINPNQLPHIHQEPAMLLCVGLLLLLIGRIIYLQGSTDSQ
DHSQV
© 1998-2020Legal notice