Dataset for protein Unclassified of organism Sinocyclocheilus rhinocerous

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A673GV92_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus rhinocerous (length=203 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGRGGEVGQTANRHGRFEDRSTQTASSVLNSVRNGDMAPFQGLEGDESSPCGAVD
ARTAFGVNCVTGGLASLTMAPGASEGPRALFHGNAGFRAHFPALFEPVLDGTQNAEEDEGRPEEKEDERDVGISVEIQIG
RKLREMGDQFQQDHLQLFLFLKWFLSRCAMTSSSVISMLHMQI
>gnl|bcl2dbpro|A0A673J7P6_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus rhinocerous (length=89 residues).
MYKIVLRSQPPDVVLRQNLRMMDPAAPRPERSVETLIGQKLQLIGDQFYQEHMMHHGNQRNQEPLWWRVAVAFYTLVFGR
EADARQNRR
>gnl|bcl2dbpro|A0A673MJJ4_uncBAD-01 Putative BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus rhinocerous (length=117 residues).
FFYRFNSVKSKSFQAPPGHLNEDQWVRQRVQSMDAELFFRKADQPWRPRVFSAPPNAAVSVKYGRRLRRIADEFDILLEK
GMKRMCNGRPASQIRRFPMSLSFLWSHEESDAERRSH
© 1998-2020Legal notice