Dataset for protein Unclassified of organism Sinocyclocheilus grahami

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A672JX19_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus grahami (length=116 residues).
YCKKISTIYGKKQQLWLPELYCNTGLLLLAPPSRSQPPDVVLRQDLRMMDPAAPRPEQSVETLIGQKLQLIGDQFYQEHM
MHHGNQRNQEPLWWRVTVAFYTLVFGREADARENRR
>gnl|bcl2dbpro|A0A672L7Z7_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus grahami (length=163 residues).
MADSIIREQTPGRGSGESAGGAAVLGSGHFDFPQPSDGDPLRGGIAMSSSHQSRSPMSRTFSRSSSGYFSVDSDSVPSSP
LMPNISEAQDGQNDEVWFAEPSHQHAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGVSNIQGFRIPLWSPTFLGDFI
LFY
>gnl|bcl2dbpro|A0A672SL07_uncBAD-01 Putative BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami (length=115 residues).
MYSLSDQHGSAPGMTKQISSSFGRPNKVVSLSQRSTQRLHDMPWRPRVFSAPPNAAASVKYGRRLRRLTDEFDILLEKGM
KRLCNGRPAPQIWRFPMSSSFLWSHAESDAERRSH
>gnl|bcl2dbpro|A0A672T0P7_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus grahami (length=235 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGPRGEVGQTANRHGRFEDRSTQTARTVLNSARDGDMAPFQGLERDASSPCGAVD
PRTAFGANCGTGGLASLTMAPGAPEGPRALFHGNAGFRSHFPALFEPVPDGTQNAEEDGGTPEEKEDERDVGISVEIQIG
RKLREMGDQFQQEHLQLVRVISDETSFFSSSLWFSLRWFLSRCAMTSSSVISMLHMQMLSELYCVFVVVKNKNSR
© 1998-2020Legal notice