Dataset for protein Unclassified of organism Sinocyclocheilus anshuiensis

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A671NFZ6_uncBAD-01 Putative BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=72 residues).
FTDQPGSETDQPWRPRVFSAPPNAAVSVKYGRRLRRITDEFDILLEKGVRRTESRELLLYLYSTNSVTCGLS
>gnl|bcl2dbpro|A0A671NJM4_uncBAD-01 Putative BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=134 residues).
VMAPKSTHSVEVSETLKDRDDSDQSEAGSPQRKQLLAVPDQWVRQRVQSMDAELFFKKADQPWRPRVFSAPPNAAVSVKY
GRRLRRITDEFDILLEKGMKRMCNGRPAPQIRRFPMSLSFLWSHEESDAERRSH
>gnl|bcl2dbpro|A0A671S371_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus anshuiensis (length=240 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGPRGEVGQTANRHGRFEDRSTQTARTVLNSARDGDMAPFQGLERDASSPCGAVD
PRTAFGANCGTGGLVSLTMAPGAPEGPRALFHGNAVFRSHFPALFEPVPDGTQNAEEDGGTPEEKEDERDVGISVEIQIG
RKLREMGDQFQQEHLQLVRVISDGTSFFSSSLWFSLQWFLSRCAMTSSSVISMLHMQILSGRDDIIFGLPLYCVFVVVKN
© 1998-2020Legal notice