Dataset for protein Unclassified of organism Salmo trutta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A673WE74_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Salmo trutta (length=198 residues).
MDDEEEDMSLQRPVSQCWGTPFRDIKFHDRESRDREDTQDRSTQTSTGPNAIVPRSEGQNIMVPQGHNNNNFPCGVQDNH
QGRILFHGNAGFRLHFPARFEPTDDRGERQNEEGRREDEERRRMEERPEEERVEDSAEARIGRKLREIGDQFHQEHVQLF
LRHQRDVLPVWIRLTMALYGFLFNREAPAVPHLRGQER
© 1998-2020Legal notice