Dataset for protein Unclassified of organism Salarias fasciatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A672GN88_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Salarias fasciatus (length=139 residues).
MDDEEEDMSRPISQLWGTSFREVKYEERAAQIAAGQAIDALPCSFHRQPRVPFHGEDGPPSLQTTGRGEENDRMAAERPE
EQAGLSVEAQIGRKLREIGDKFHQDHVELQRVCVWVDWAGCLYARLKIEPDSHAYRRSQ
© 1998-2020Legal notice