Dataset for protein Bmf of organism Salarias fasciatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A672HG10_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Salarias fasciatus GN=BMF (length=165 residues).
MDDEEDDVFEPDPRCWRTAFREIKCEDRGTQTPGPVLVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDHRVRR
RESEEQQNGMDQLPRQRPAAQSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLATTLLSLLFDRGVIAGGGGG
GAGRR
© 1998-2020Legal notice