Dataset for protein Bmf of organism Rhinopithecus roxellana

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K6RAW1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus roxellana GN=BMF (length=123 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRRE
>gnl|bcl2dbpro|A0A2K6RAW1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus roxellana GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
© 1998-2020Legal notice