Dataset for protein Bim of organism Rhinopithecus bieti

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=117 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
TSLWFGFIFTGLDLYVVWIYIYHHSQDTEQLNHRDFS
© 1998-2020Legal notice